PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400044274
Common NameLOC102605234
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 233aa    MW: 27065.8 Da    PI: 9.6268
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400044274genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF984e-31959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fs++g+lyeys+
  PGSC0003DMP400044274  9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSN 59
                          79***********************************************95 PP

2K-box96.83.3e-32791736100
                 K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                              ++e +a+ +qqe++kL+++i+ +q+++Rhl+Ge+L sL+++eL+qLe++Le+++++iRskK+e +l+++e+l k+e +l++en  L
  PGSC0003DMP400044274  79 AYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGLCSLNVRELKQLENRLERGITRIRSKKHEAILAETENLHKREIQLEQENAFL 167
                           33478999********************************************************************************* PP

                 K-box  95 rkklee 100
                           r+k++e
  PGSC0003DMP400044274 168 RSKIAE 173
                           ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.852161IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-41160IPR002100Transcription factor, MADS-box
CDDcd002652.07E-43278No hitNo description
SuperFamilySSF554555.62E-33279IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-323859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-2583171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.40887177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFST RGRLYEYSNN  60
NVKATIERYK KATAETSSAY TTQELNAQFY QQESKKLRQQ IQLMQNTNRH LVGEGLCSLN  120
VRELKQLENR LERGITRIRS KKHEAILAET ENLHKREIQL EQENAFLRSK IAENERLQEL  180
SMMPSGEQGG EEYNAFQQYL ARNMLQLNMM ETAVPSYDPL SPDHKRSHLQ LQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-21169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-21169169Myocyte-specific enhancer factor 2B
1tqe_R3e-21169169Myocyte-specific enhancer factor 2B
1tqe_S3e-21169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987360.0AY098736.2 Lycopersicon esculentum TAGL11 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339358.11e-171PREDICTED: agamous-like MADS-box protein AGL11
SwissprotQ388367e-96AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLM1CEC21e-171M1CEC2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000656141e-170(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.14e-97MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]